PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 764aa    MW: 84927.2 Da    PI: 6.6686
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-16654PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.15.6e-10356397346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT eE   +++av+ +G++ ++ I+r++  +R++ +ck ++ k
        Lsa011298 356 DWTDEEKSSFLQAVRSYGKD-FSMISRCLK-KRSRDECKVFYSK 397
                      6*****************99.********9.********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-11210270IPR009057Homeodomain-like
PROSITE profilePS5129311.339222273IPR017884SANT domain
SMARTSM007171.3E-6223271IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-11351403IPR009057Homeodomain-like
PROSITE profilePS5129312.117352403IPR017884SANT domain
PfamPF159638.6E-8353397No hitNo description
SMARTSM007173.6E-7353401IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-6355397IPR009057Homeodomain-like
CDDcd001674.62E-7357395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
XEDVGNDDVL GFVPSCGDRS SSTVSDGEDV DNGREDDKLY HFIFATNKVI ANETSDELNR  60
ILLPTTHLCN KISKSTDESL NKTKIASRKR FLKLKERVIT SKFRVLQHAW KEDLQLLSVK  120
KTGGKSQKKF ESSSRMGYAD HQKYCSSIHS RLYPSGGSVS LVPSTEALDY VKKLLSDSRV  180
KVQRKTLKMP CLILDRSERM MTRFVSDNGL VEDPVEVEKE RSIVGXLEEE EQKIFLEKYS  240
LFGKDFKKIA SFLKNKTCGD CVEFYYKNHK SDCFQKIKKK SAFAKGMSCI TNTYLVTSGR  300
RMAADATSLE MLGAASEMVA SVDGEHKLHS EMFCNAQETG AGDESCGGEM NPTSSDWTDE  360
EKSSFLQAVR SYGKDFSMIS RCLKKRSRDE CKVFYSKARK CLGLDSIHSK AGDGGDDGDV  420
DHGHDDTCMV DSGSVISCDK SSSDVKMEVE DLLHSSDSKQ EVPESESEQI VVKEESKQLQ  480
DLNSRDSSIC MDLSIEQQPV NNNNTNHMEL NGVEKSKGCE DNGFLPGVSS HRKSVSQDDI  540
DTSSRLSFRK SIGGSQRCSS TDGYHHLPKH SLMDCVESSQ VVQKDENLLP EHCLPRDSCL  600
QKPSQRQRQG EGEGDVKLFG QILIKPSLSL SGSKTNTSSL QENGEKRKSS FNLKFDIDNN  660
TNNDHGLSEV PLRRSYGFWD GNRIQTTGFP SLPDPSSILV SGFGNSSSSS SVKTGFQTRQ  720
VYSYKNQEPF KGVLVSDPVA AIRMHYAKTE QYNNGSNSGD IGSR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103YIK91e-140A0A103YIK9_CYNCS; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-53MYB family protein